RGS5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RGS5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7015
• Hersteller Artikelnummer: A7015
• Alternativnummer: ABB-A7015-100UL,ABB-A7015-20UL,ABB-A7015-500UL,ABB-A7015-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129, RGS5

Produktbeschreibung

This locus represents naturally occurring readthrough transcription between the neighboring LOC127814295 (uncharacterized LOC127814295) and RGS5 (regulator of G-protein signaling 5) genes on chromosome 1. Some variants of the readthrough transcript encode novel proteins with unique N-termini.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 21kDa
• NCBI: 8490
• UniProt: O15539
• Reinheit: Affinity purification
• Sequenz: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
• Target-Kategorie: RGS5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cardiovascular,Angiogenesis,Blood,Heart,Hypertrophy. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse heart, using RGS5 Rabbit pAb (A7015) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.