RGS5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RGS5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7015
• Supplier Catalog Number: A7015
• Alternative Catalog Number: ABB-A7015-100UL,ABB-A7015-20UL,ABB-A7015-500UL,ABB-A7015-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129, RGS5

Product Description

This locus represents naturally occurring readthrough transcription between the neighboring LOC127814295 (uncharacterized LOC127814295) and RGS5 (regulator of G-protein signaling 5) genes on chromosome 1. Some variants of the readthrough transcript encode novel proteins with unique N-termini.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 8490
• UniProt: O15539
• Purity: Affinity purification
• Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
• Target: RGS5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cardiovascular,Angiogenesis,Blood,Heart,Hypertrophy. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse heart, using RGS5 Rabbit pAb (A7015) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.