NPFF Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NPFF Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7020
• Hersteller Artikelnummer: A7020
• Alternativnummer: ABB-A7020-100UL,ABB-A7020-20UL,ABB-A7020-500UL,ABB-A7020-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FMRFAL, NPFF

Produktbeschreibung

This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 12kDa
• NCBI: 8620
• UniProt: O15130
• Reinheit: Affinity purification
• Sequenz: AEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
• Target-Kategorie: NPFF
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat plasma, using NPFF Rabbit pAb (A7020) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min.