NPFF Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NPFF Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7020
• Supplier Catalog Number: A7020
• Alternative Catalog Number: ABB-A7020-100UL,ABB-A7020-20UL,ABB-A7020-500UL,ABB-A7020-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FMRFAL, NPFF

Product Description

This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 8620
• UniProt: O15130
• Purity: Affinity purification
• Sequence: AEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
• Target: NPFF
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat plasma, using NPFF Rabbit pAb (A7020) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min.