ALDH1L1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ALDH1L1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7067
• Hersteller Artikelnummer: A7067
• Alternativnummer: ABB-A7067-20UL,ABB-A7067-100UL,ABB-A7067-500UL,ABB-A7067-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FDH, FTHFD, 10-fTHF, 10-FTHFDH, ALDH1L1

Produktbeschreibung

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 99kDa
• NCBI: 10840
• UniProt: O75891
• Reinheit: Affinity purification
• Sequenz: MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLN
• Target-Kategorie: ALDH1L1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Caspases,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,Neuroscience, Cell Type Marker,Astrocyte marker. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ALDH1L1 Rabbit pAb (A7067) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.