ALDH1L1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ALDH1L1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7067
• Supplier Catalog Number: A7067
• Alternative Catalog Number: ABB-A7067-20UL,ABB-A7067-100UL,ABB-A7067-500UL,ABB-A7067-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FDH, FTHFD, 10-fTHF, 10-FTHFDH, ALDH1L1

Product Description

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 99kDa
• NCBI: 10840
• UniProt: O75891
• Purity: Affinity purification
• Sequence: MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLN
• Target: ALDH1L1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Caspases,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,Neuroscience, Cell Type Marker,Astrocyte marker. Shipping: Ice Bag

Images

Western blot analysis of various lysates using ALDH1L1 Rabbit pAb (A7067) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.