MORF4L1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MORF4L1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7071
• Hersteller Artikelnummer: A7071
• Alternativnummer: ABB-A7071-100UL,ABB-A7071-20UL,ABB-A7071-500UL,ABB-A7071-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15, MORF4L1

Produktbeschreibung

Enables protein N-terminus binding activity. Involved in double-strand break repair via homologous recombination and histone modification. Located in nuclear speck. Part of NuA4 histone acetyltransferase complex and Sin3 complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 41kDa
• NCBI: 10933
• UniProt: Q9UBU8
• Reinheit: Affinity purification
• Sequenz: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
• Target-Kategorie: MORF4L1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using MORF4L1 Rabbit pAb (A7071) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.