MORF4L1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MORF4L1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7071
• Supplier Catalog Number: A7071
• Alternative Catalog Number: ABB-A7071-100UL,ABB-A7071-20UL,ABB-A7071-500UL,ABB-A7071-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15, MORF4L1

Product Description

Enables protein N-terminus binding activity. Involved in double-strand break repair via homologous recombination and histone modification. Located in nuclear speck. Part of NuA4 histone acetyltransferase complex and Sin3 complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 10933
• UniProt: Q9UBU8
• Purity: Affinity purification
• Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
• Target: MORF4L1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MORF4L1 Rabbit pAb (A7071) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.