MTF2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MTF2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7077
• Hersteller Artikelnummer: A7077
• Alternativnummer: ABB-A7077-100UL,ABB-A7077-20UL,ABB-A7077-500UL,ABB-A7077-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: M96, PCL2, TDRD19A, dJ976O13.2, MTF2

Produktbeschreibung

Enables methylated histone binding activity and transcription corepressor binding activity. Predicted to be involved in several processes, including regulation of histone H3-K27 methylation, regulation of transcription by RNA polymerase II, and segment specification. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in cytoplasm, focal adhesion, and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 67kDa
• NCBI: 22823
• UniProt: Q9Y483
• Reinheit: Affinity purification
• Sequenz: MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLE
• Target-Kategorie: MTF2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using MTF2 Rabbit pAb (A7077) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.