MTF2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MTF2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7077
• Supplier Catalog Number: A7077
• Alternative Catalog Number: ABB-A7077-100UL,ABB-A7077-20UL,ABB-A7077-500UL,ABB-A7077-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: M96, PCL2, TDRD19A, dJ976O13.2, MTF2

Product Description

Enables methylated histone binding activity and transcription corepressor binding activity. Predicted to be involved in several processes, including regulation of histone H3-K27 methylation, regulation of transcription by RNA polymerase II, and segment specification. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in cytoplasm, focal adhesion, and nucleoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 67kDa
• NCBI: 22823
• UniProt: Q9Y483
• Purity: Affinity purification
• Sequence: MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLE
• Target: MTF2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MTF2 Rabbit pAb (A7077) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.