LAP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7101
- Bilder (1)
| Artikelname: | LAP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7101 |
| Hersteller Artikelnummer: | A7101 |
| Alternativnummer: | ABB-A7101-100UL,ABB-A7101-20UL,ABB-A7101-500UL,ABB-A7101-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LAP, PEPS, LAPEP, HEL-S-106, LAP3 |
| Predicted to enable peptidase activity. Predicted to be involved in proteolysis. Located in cytosol, midbody, and nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 56kDa |
| NCBI: | 51056 |
| UniProt: | P28838 |
| Reinheit: | Affinity purification |
| Sequenz: | VFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRF |
| Target-Kategorie: | LAP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Cardiovascular,Blood. Shipping: Ice Bag |

