LAP3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: LAP3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7101
• Hersteller Artikelnummer: A7101
• Alternativnummer: ABB-A7101-100UL,ABB-A7101-20UL,ABB-A7101-500UL,ABB-A7101-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LAP, PEPS, LAPEP, HEL-S-106, LAP3

Produktbeschreibung

Predicted to enable peptidase activity. Predicted to be involved in proteolysis. Located in cytosol, midbody, and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 56kDa
• NCBI: 51056
• UniProt: P28838
• Reinheit: Affinity purification
• Sequenz: VFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRF
• Target-Kategorie: LAP3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Cardiovascular,Blood. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using LAP3 Rabbit pAb (A7101) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.