LAP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7101
Article Name: LAP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7101
Supplier Catalog Number: A7101
Alternative Catalog Number: ABB-A7101-100UL,ABB-A7101-20UL,ABB-A7101-500UL,ABB-A7101-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LAP, PEPS, LAPEP, HEL-S-106, LAP3
Predicted to enable peptidase activity. Predicted to be involved in proteolysis. Located in cytosol, midbody, and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 51056
UniProt: P28838
Purity: Affinity purification
Sequence: VFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRF
Target: LAP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using LAP3 Rabbit pAb (A7101) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.