HSPA14 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HSPA14 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7107
• Hersteller Artikelnummer: A7107
• Alternativnummer: ABB-A7107-20UL,ABB-A7107-100UL,ABB-A7107-1000UL,ABB-A7107-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HSP70-4, HSP70L1, MSANTD7, HSPA14

Produktbeschreibung

Predicted to enable several functions, including ATP binding activity, misfolded protein binding activity, and unfolded protein binding activity. Predicted to be involved in several processes, including cellular response to unfolded protein, chaperone cofactor-dependent protein refolding, and protein refolding. Located in cytosol. Colocalizes with ribosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 55kDa
• NCBI: 51182
• UniProt: Q0VDF9
• Reinheit: Affinity purification
• Sequenz: ASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTD
• Target-Kategorie: HSPA14
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using HSPA14 Rabbit pAb (A7107) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.