HSPA14 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HSPA14 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7107
• Supplier Catalog Number: A7107
• Alternative Catalog Number: ABB-A7107-20UL,ABB-A7107-100UL,ABB-A7107-1000UL,ABB-A7107-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HSP70-4, HSP70L1, MSANTD7, HSPA14

Product Description

Predicted to enable several functions, including ATP binding activity, misfolded protein binding activity, and unfolded protein binding activity. Predicted to be involved in several processes, including cellular response to unfolded protein, chaperone cofactor-dependent protein refolding, and protein refolding. Located in cytosol. Colocalizes with ribosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 55kDa
• NCBI: 51182
• UniProt: Q0VDF9
• Purity: Affinity purification
• Sequence: ASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTD
• Target: HSPA14
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using HSPA14 Rabbit pAb (A7107) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.