MTFP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MTFP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7110
• Hersteller Artikelnummer: A7110
• Alternativnummer: ABB-A7110-20UL,ABB-A7110-100UL,ABB-A7110-1000UL,ABB-A7110-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MTP18, HSPC242, MTFP1

Produktbeschreibung

MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 18kDa
• NCBI: 51537
• UniProt: Q9UDX5
• Reinheit: Affinity purification
• Sequenz: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
• Target-Kategorie: MTFP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Cardiovascular,Heart. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using MTFP1 Rabbit pAb (A7110) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.