MTFP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MTFP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7110
• Supplier Catalog Number: A7110
• Alternative Catalog Number: ABB-A7110-20UL,ABB-A7110-100UL,ABB-A7110-1000UL,ABB-A7110-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MTP18, HSPC242, MTFP1

Product Description

MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 18kDa
• NCBI: 51537
• UniProt: Q9UDX5
• Purity: Affinity purification
• Sequence: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
• Target: MTFP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Cardiovascular,Heart. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using MTFP1 Rabbit pAb (A7110) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.