METTL13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7111
Artikelname: METTL13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7111
Hersteller Artikelnummer: A7111
Alternativnummer: ABB-A7111-20UL,ABB-A7111-100UL,ABB-A7111-500UL,ABB-A7111-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: feat, DFNM1, CGI-01, DFNB26, DFNB26M, KIAA0859, EEF1AKNMT, 5630401D24Rik, METTL13
Predicted to enable methyltransferase activity. Involved in negative regulation of cell cycle G1/S phase transition and negative regulation of transcription by RNA polymerase II. Predicted to be located in mitochondrion and nucleus.
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 51603
UniProt: Q8N6R0
Reinheit: Affinity purification
Sequenz: SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Target-Kategorie: METTL13
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using METTL13 Rabbit pAb (A7111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.