METTL13 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: METTL13 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7111
• Hersteller Artikelnummer: A7111
• Alternativnummer: ABB-A7111-20UL,ABB-A7111-100UL,ABB-A7111-500UL,ABB-A7111-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: feat, DFNM1, CGI-01, DFNB26, DFNB26M, KIAA0859, EEF1AKNMT, 5630401D24Rik, METTL13

Produktbeschreibung

Predicted to enable methyltransferase activity. Involved in negative regulation of cell cycle G1/S phase transition and negative regulation of transcription by RNA polymerase II. Predicted to be located in mitochondrion and nucleus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 79kDa
• NCBI: 51603
• UniProt: Q8N6R0
• Reinheit: Affinity purification
• Sequenz: SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
• Target-Kategorie: METTL13
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using METTL13 Rabbit pAb (A7111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.