METTL13 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: METTL13 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7111
• Supplier Catalog Number: A7111
• Alternative Catalog Number: ABB-A7111-20UL,ABB-A7111-100UL,ABB-A7111-500UL,ABB-A7111-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: feat, DFNM1, CGI-01, DFNB26, DFNB26M, KIAA0859, EEF1AKNMT, 5630401D24Rik, METTL13

Product Description

Predicted to enable methyltransferase activity. Involved in negative regulation of cell cycle G1/S phase transition and negative regulation of transcription by RNA polymerase II. Predicted to be located in mitochondrion and nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 79kDa
• NCBI: 51603
• UniProt: Q8N6R0
• Purity: Affinity purification
• Sequence: SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
• Target: METTL13
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of various lysates using METTL13 Rabbit pAb (A7111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.