CRISP2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CRISP2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7177
• Hersteller Artikelnummer: A7177
• Alternativnummer: ABB-A7177-20UL,ABB-A7177-100UL,ABB-A7177-500UL,ABB-A7177-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CT36, TPX1, TSP1, GAPDL5, CRISP-2, CRISP2

Produktbeschreibung

Predicted to be involved in cell-cell adhesion. Predicted to be active in extracellular space.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 27kDa
• NCBI: 7180
• UniProt: P16562
• Reinheit: Affinity purification
• Sequenz: KDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
• Target-Kategorie: CRISP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CRISP2 Rabbit pAb (A7177) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.