CRISP2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CRISP2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7177
• Supplier Catalog Number: A7177
• Alternative Catalog Number: ABB-A7177-20UL,ABB-A7177-100UL,ABB-A7177-500UL,ABB-A7177-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CT36, TPX1, TSP1, GAPDL5, CRISP-2, CRISP2

Product Description

Predicted to be involved in cell-cell adhesion. Predicted to be active in extracellular space.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 7180
• UniProt: P16562
• Purity: Affinity purification
• Sequence: KDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
• Target: CRISP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CRISP2 Rabbit pAb (A7177) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.