NAT9 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NAT9 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7204
• Hersteller Artikelnummer: A7204
• Alternativnummer: ABB-A7204-100UL,ABB-A7204-20UL,ABB-A7204-1000UL,ABB-A7204-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EBSP, hNATL, NAT9

Produktbeschreibung

Predicted to enable N-acetyltransferase activity. Predicted to be involved in protein acetylation. Part of protein-containing complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 23kDa
• NCBI: 26151
• UniProt: Q9BTE0
• Reinheit: Affinity purification
• Sequenz: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
• Target-Kategorie: NAT9
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from SK-MEL-28 cells, using NAT9 Rabbit pAb (A7204) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.