NAT9 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NAT9 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7204
• Supplier Catalog Number: A7204
• Alternative Catalog Number: ABB-A7204-100UL,ABB-A7204-20UL,ABB-A7204-1000UL,ABB-A7204-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EBSP, hNATL, NAT9

Product Description

Predicted to enable N-acetyltransferase activity. Predicted to be involved in protein acetylation. Part of protein-containing complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 23kDa
• NCBI: 26151
• UniProt: Q9BTE0
• Purity: Affinity purification
• Sequence: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
• Target: NAT9
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Images

Western blot analysis of lysates from SK-MEL-28 cells, using NAT9 Rabbit pAb (A7204) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.