TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7224
• Hersteller Artikelnummer: A7224
• Alternativnummer: ABB-A7224-20UL,ABB-A7224-100UL,ABB-A7224-1000UL,ABB-A7224-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P53AIP1, TP53AIP1

Produktbeschreibung

This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 13kDa
• NCBI: 63970
• UniProt: Q9HCN2
• Reinheit: Affinity purification
• Sequenz: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
• Target-Kategorie: TP53AIP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TP53AIP1 Rabbit pAb (A7224) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.