TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7224
• Supplier Catalog Number: A7224
• Alternative Catalog Number: ABB-A7224-20UL,ABB-A7224-100UL,ABB-A7224-1000UL,ABB-A7224-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: P53AIP1, TP53AIP1

Product Description

This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 13kDa
• NCBI: 63970
• UniProt: Q9HCN2
• Purity: Affinity purification
• Sequence: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
• Target: TP53AIP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TP53AIP1 Rabbit pAb (A7224) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.