UBE2Z Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: UBE2Z Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7225
• Hersteller Artikelnummer: A7225
• Alternativnummer: ABB-A7225-100UL,ABB-A7225-20UL,ABB-A7225-500UL,ABB-A7225-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: USE1, HOYS7, UBE2Z

Produktbeschreibung

This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 65264
• UniProt: Q9H832
• Reinheit: Affinity purification
• Sequenz: PPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
• Target-Kategorie: UBE2Z
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using UBE2Z Rabbit pAb (A7225) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.