UBE2Z Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UBE2Z Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7225
• Supplier Catalog Number: A7225
• Alternative Catalog Number: ABB-A7225-100UL,ABB-A7225-20UL,ABB-A7225-500UL,ABB-A7225-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: USE1, HOYS7, UBE2Z

Product Description

This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 65264
• UniProt: Q9H832
• Purity: Affinity purification
• Sequence: PPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
• Target: UBE2Z
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UBE2Z Rabbit pAb (A7225) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.