UBE2Z Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7225
Article Name: UBE2Z Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7225
Supplier Catalog Number: A7225
Alternative Catalog Number: ABB-A7225-100UL,ABB-A7225-20UL,ABB-A7225-500UL,ABB-A7225-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: USE1, HOYS7, UBE2Z
This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 65264
UniProt: Q9H832
Purity: Affinity purification
Sequence: PPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Target: UBE2Z
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using UBE2Z Rabbit pAb (A7225) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.