RNF7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RNF7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7301
• Hersteller Artikelnummer: A7301
• Alternativnummer: ABB-A7301-20UL,ABB-A7301-100UL,ABB-A7301-500UL,ABB-A7301-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SAG, ROC2, rbx2, CKBBP1, RNF7

Produktbeschreibung

The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 13kDa
• NCBI: 9616
• UniProt: Q9UBF6
• Reinheit: Affinity purification
• Sequenz: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
• Target-Kategorie: RNF7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Immunofluorescence analysis of MCF-7 cells using RNF7 Rabbit pAb (A7301). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.