RNF7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7301
Article Name: RNF7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7301
Supplier Catalog Number: A7301
Alternative Catalog Number: ABB-A7301-20UL,ABB-A7301-100UL,ABB-A7301-500UL,ABB-A7301-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SAG, ROC2, rbx2, CKBBP1, RNF7
The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 9616
UniProt: Q9UBF6
Purity: Affinity purification
Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Target: RNF7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism. Shipping: Ice Bag
Immunofluorescence analysis of MCF-7 cells using RNF7 Rabbit pAb (A7301). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.