ARHGAP44 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ARHGAP44 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7357
• Hersteller Artikelnummer: A7357
• Alternativnummer: ABB-A7357-100UL,ABB-A7357-20UL,ABB-A7357-500UL,ABB-A7357-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RICH2, NPC-A-10, ARHGAP44

Produktbeschreibung

Enables phospholipid binding activity. Predicted to be involved in several processes, including modification of dendritic spine, negative regulation of Rac protein signal transduction, and regulation of plasma membrane bounded cell projection organization. Located in leading edge membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 89kDa
• NCBI: 9912
• UniProt: Q17R89
• Reinheit: Affinity purification
• Sequenz: MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST
• Target-Kategorie: ARHGAP44
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ARHGAP44 Rabbit pAb (A7357) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.