ARHGAP44 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ARHGAP44 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7357
• Supplier Catalog Number: A7357
• Alternative Catalog Number: ABB-A7357-100UL,ABB-A7357-20UL,ABB-A7357-500UL,ABB-A7357-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RICH2, NPC-A-10, ARHGAP44

Product Description

Enables phospholipid binding activity. Predicted to be involved in several processes, including modification of dendritic spine, negative regulation of Rac protein signal transduction, and regulation of plasma membrane bounded cell projection organization. Located in leading edge membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 89kDa
• NCBI: 9912
• UniProt: Q17R89
• Purity: Affinity purification
• Sequence: MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST
• Target: ARHGAP44
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag

Images

Western blot analysis of various lysates using ARHGAP44 Rabbit pAb (A7357) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.