CHRAC1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CHRAC1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7372
• Hersteller Artikelnummer: A7372
• Alternativnummer: ABB-A7372-100UL,ABB-A7372-20UL,ABB-A7372-1000UL,ABB-A7372-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: YCL1, CHARC1, CHARC15, CHRAC-1, CHRAC15, CHRAC-15, CHRAC1

Produktbeschreibung

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 15kDa
• NCBI: 54108
• UniProt: Q9NRG0
• Reinheit: Affinity purification
• Sequenz: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
• Target-Kategorie: CHRAC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CHRAC1 Rabbit pAb (A7372) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.