CHRAC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7372
Article Name: CHRAC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7372
Supplier Catalog Number: A7372
Alternative Catalog Number: ABB-A7372-100UL,ABB-A7372-20UL,ABB-A7372-1000UL,ABB-A7372-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: YCL1, CHARC1, CHARC15, CHRAC-1, CHRAC15, CHRAC-15, CHRAC1
CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 54108
UniProt: Q9NRG0
Purity: Affinity purification
Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Target: CHRAC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling. Shipping: Ice Bag
Western blot analysis of various lysates using CHRAC1 Rabbit pAb (A7372) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.