FAM173B Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FAM173B Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7403
• Hersteller Artikelnummer: A7403
• Alternativnummer: ABB-A7403-20UL,ABB-A7403-100UL,ABB-A7403-500UL,ABB-A7403-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: JS-2, FAM173B, hFAM173B

Produktbeschreibung

Enables protein-lysine N-methyltransferase activity. Involved in peptidyl-lysine trimethylation, positive regulation of sensory perception of pain, and regulation of proton transport. Located in mitochondrial crista.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 26kDa
• NCBI: 134145
• UniProt: Q6P4H8
• Reinheit: Affinity purification
• Sequenz: MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA
• Target-Kategorie: ATPSCKMT
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FAM173B Rabbit pAb (A7403) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.