FAM173B Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FAM173B Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7403
• Supplier Catalog Number: A7403
• Alternative Catalog Number: ABB-A7403-20UL,ABB-A7403-100UL,ABB-A7403-500UL,ABB-A7403-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: JS-2, FAM173B, hFAM173B

Product Description

Enables protein-lysine N-methyltransferase activity. Involved in peptidyl-lysine trimethylation, positive regulation of sensory perception of pain, and regulation of proton transport. Located in mitochondrial crista.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 26kDa
• NCBI: 134145
• UniProt: Q6P4H8
• Purity: Affinity purification
• Sequence: MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA
• Target: ATPSCKMT
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using FAM173B Rabbit pAb (A7403) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.