SIRT6 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SIRT6 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7416
• Hersteller Artikelnummer: A7416
• Alternativnummer: ABB-A7416-20UL,ABB-A7416-100UL,ABB-A7416-500UL,ABB-A7416-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Sir2l6, mSIRT6, 2810449N18Rik, SIRT6

Produktbeschreibung

Enables several functions, including NAD(P)+-protein-arginine ADP-ribosyltransferase activity, NAD-dependent histone deacetylase activity (H3-K9 specific), and transcription corepressor activity. Involved in several processes, including cellular protein modification process, negative regulation of nucleobase-containing compound metabolic process, and positive regulation of cell population proliferation. Located in nucleus. Is expressed in several structures, including alimentary system, central nervous system, gonad, musculature, and retina. Used to study progeria. Orthologous to human SIRT6 (sirtuin 6).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36 kDa/39 kDa
• NCBI: 50721
• UniProt: Q8N6T7
• Reinheit: Affinity purification
• Sequenz: NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
• Target-Kategorie: Sirt6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics & Nuclear Signaling,Chromatin Modifying Enzymes,Deacetylation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SIRT6 Rabbit pAb (A7416) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.