SIRT6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SIRT6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7416
• Supplier Catalog Number: A7416
• Alternative Catalog Number: ABB-A7416-20UL,ABB-A7416-100UL,ABB-A7416-500UL,ABB-A7416-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Sir2l6, mSIRT6, 2810449N18Rik, SIRT6

Product Description

Enables several functions, including NAD(P)+-protein-arginine ADP-ribosyltransferase activity, NAD-dependent histone deacetylase activity (H3-K9 specific), and transcription corepressor activity. Involved in several processes, including cellular protein modification process, negative regulation of nucleobase-containing compound metabolic process, and positive regulation of cell population proliferation. Located in nucleus. Is expressed in several structures, including alimentary system, central nervous system, gonad, musculature, and retina. Used to study progeria. Orthologous to human SIRT6 (sirtuin 6).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36 kDa/39 kDa
• NCBI: 50721
• UniProt: Q8N6T7
• Purity: Affinity purification
• Sequence: NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
• Target: Sirt6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics & Nuclear Signaling,Chromatin Modifying Enzymes,Deacetylation. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SIRT6 Rabbit pAb (A7416) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.