ZBTB48 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7435
- Bilder (1)
| Artikelname: | ZBTB48 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7435 |
| Hersteller Artikelnummer: | A7435 |
| Alternativnummer: | ABB-A7435-100UL,ABB-A7435-20UL,ABB-A7435-1000UL,ABB-A7435-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HKR3, TZAP, ZNF855, pp9964, ZBTB48 |
| Enables double-stranded telomeric DNA binding activity, identical protein binding activity, and transcription cis-regulatory region binding activity. Involved in positive regulation of transcription, DNA-templated and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 77kDa |
| NCBI: | 3104 |
| UniProt: | P10074 |
| Reinheit: | Affinity purification |
| Sequenz: | MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTR |
| Target-Kategorie: | ZBTB48 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |

