ZBTB48 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ZBTB48 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7435
• Hersteller Artikelnummer: A7435
• Alternativnummer: ABB-A7435-100UL,ABB-A7435-20UL,ABB-A7435-1000UL,ABB-A7435-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HKR3, TZAP, ZNF855, pp9964, ZBTB48

Produktbeschreibung

Enables double-stranded telomeric DNA binding activity, identical protein binding activity, and transcription cis-regulatory region binding activity. Involved in positive regulation of transcription, DNA-templated and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 77kDa
• NCBI: 3104
• UniProt: P10074
• Reinheit: Affinity purification
• Sequenz: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTR
• Target-Kategorie: ZBTB48
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from 293F cells, using ZBTB48 Rabbit pAb (A7435) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.