ZBTB48 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ZBTB48 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7435
• Supplier Catalog Number: A7435
• Alternative Catalog Number: ABB-A7435-100UL,ABB-A7435-20UL,ABB-A7435-1000UL,ABB-A7435-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HKR3, TZAP, ZNF855, pp9964, ZBTB48

Product Description

Enables double-stranded telomeric DNA binding activity, identical protein binding activity, and transcription cis-regulatory region binding activity. Involved in positive regulation of transcription, DNA-templated and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 77kDa
• NCBI: 3104
• UniProt: P10074
• Purity: Affinity purification
• Sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTR
• Target: ZBTB48
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of lysates from 293F cells, using ZBTB48 Rabbit pAb (A7435) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.