RARG Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RARG Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7448
• Hersteller Artikelnummer: A7448
• Alternativnummer: ABB-A7448-20UL,ABB-A7448-100UL,ABB-A7448-500UL,ABB-A7448-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RARC, NR1B3, RARgamma, RARG

Produktbeschreibung

This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 5916
• UniProt: P13631
• Reinheit: Affinity purification
• Sequenz: KKEVKEEGSPDSYELSPQLEELITKVSKAHQE
• Target-Kategorie: RARG
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using RARG Rabbit pAb (A7448) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.