RARG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7448
Article Name: RARG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7448
Supplier Catalog Number: A7448
Alternative Catalog Number: ABB-A7448-20UL,ABB-A7448-100UL,ABB-A7448-500UL,ABB-A7448-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RARC, NR1B3, RARgamma, RARG
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 5916
UniProt: P13631
Purity: Affinity purification
Sequence: KKEVKEEGSPDSYELSPQLEELITKVSKAHQE
Target: RARG
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using RARG Rabbit pAb (A7448) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.