SH3GL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7449
- Bilder (1)
| Artikelname: | SH3GL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7449 |
| Hersteller Artikelnummer: | A7449 |
| Alternativnummer: | ABB-A7449-100UL,ABB-A7449-20UL,ABB-A7449-1000UL,ABB-A7449-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EEN, CNSA1, SH3P8, SH3D2B, SH3GL1 |
| This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 6455 |
| UniProt: | Q99961 |
| Reinheit: | Affinity purification |
| Sequenz: | VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ |
| Target-Kategorie: | SH3GL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Monkey. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |

