SH3GL1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SH3GL1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7449
• Supplier Catalog Number: A7449
• Alternative Catalog Number: ABB-A7449-100UL,ABB-A7449-20UL,ABB-A7449-1000UL,ABB-A7449-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EEN, CNSA1, SH3P8, SH3D2B, SH3GL1

Product Description

This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 6455
• UniProt: Q99961
• Purity: Affinity purification
• Sequence: VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ
• Target: SH3GL1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat,Monkey. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of lysates from COS-7 cells, using SH3GL1 Rabbit pAb (A7449) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.