NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7455
• Hersteller Artikelnummer: A7455
• Alternativnummer: ABB-A7455-100UL,ABB-A7455-20UL,ABB-A7455-1000UL,ABB-A7455-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TLL, TLX, XTLL, NR2E1/TLX

Produktbeschreibung

The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 43kDa
• NCBI: 7101
• UniProt: Q9Y466
• Reinheit: Affinity purification
• Sequenz: YFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
• Target-Kategorie: NR2E1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from U-251MG cells, using NR2E1/TLX Rabbit pAb (A7455) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.