NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7455
• Supplier Catalog Number: A7455
• Alternative Catalog Number: ABB-A7455-100UL,ABB-A7455-20UL,ABB-A7455-1000UL,ABB-A7455-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TLL, TLX, XTLL, NR2E1/TLX

Product Description

The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 7101
• UniProt: Q9Y466
• Purity: Affinity purification
• Sequence: YFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
• Target: NR2E1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from U-251MG cells, using NR2E1/TLX Rabbit pAb (A7455) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.