NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7455
Article Name: NR2E1/TLX Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7455
Supplier Catalog Number: A7455
Alternative Catalog Number: ABB-A7455-100UL,ABB-A7455-20UL,ABB-A7455-1000UL,ABB-A7455-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TLL, TLX, XTLL, NR2E1/TLX
The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 7101
UniProt: Q9Y466
Purity: Affinity purification
Sequence: YFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
Target: NR2E1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from U-251MG cells, using NR2E1/TLX Rabbit pAb (A7455) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.