PALB2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PALB2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A8373
• Hersteller Artikelnummer: A8373
• Alternativnummer: ABB-A8373-20UL,ABB-A8373-100UL,ABB-A8373-1000UL,ABB-A8373-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FANCN, PNCA3, PALB2

Produktbeschreibung

This gene encodes a protein that may function in tumor suppression. This protein binds to and colocalizes with the breast cancer 2 early onset protein (BRCA2) in nuclear foci and likely permits the stable intranuclear localization and accumulation of BRCA2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 131kDa
• NCBI: 79728
• UniProt: Q86YC2
• Reinheit: Affinity purification
• Sequenz: TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH
• Target-Kategorie: PALB2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PALB2 Rabbit pAb (A8373) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.