PALB2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PALB2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8373
• Supplier Catalog Number: A8373
• Alternative Catalog Number: ABB-A8373-20UL,ABB-A8373-100UL,ABB-A8373-1000UL,ABB-A8373-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FANCN, PNCA3, PALB2

Product Description

This gene encodes a protein that may function in tumor suppression. This protein binds to and colocalizes with the breast cancer 2 early onset protein (BRCA2) in nuclear foci and likely permits the stable intranuclear localization and accumulation of BRCA2.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 131kDa
• NCBI: 79728
• UniProt: Q86YC2
• Purity: Affinity purification
• Sequence: TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH
• Target: PALB2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PALB2 Rabbit pAb (A8373) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.