TAMM41 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8374
- Bilder (1)
| Artikelname: | TAMM41 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8374 |
| Hersteller Artikelnummer: | A8374 |
| Alternativnummer: | ABB-A8374-20UL,ABB-A8374-100UL,ABB-A8374-500UL,ABB-A8374-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RAM41, TAM41, C3orf31, COXPD56, TAMM41 |
| Predicted to enable phosphatidate cytidylyltransferase activity. Predicted to be involved in CDP-diacylglycerol biosynthetic process and cardiolipin biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be extrinsic component of mitochondrial inner membrane. Predicted to be active in mitochondrion. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 51kDa |
| NCBI: | 132001 |
| UniProt: | Q96BW9 |
| Reinheit: | Affinity purification |
| Sequenz: | SLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQV |
| Target-Kategorie: | TAMM41 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

