TAMM41 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TAMM41 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8374
• Supplier Catalog Number: A8374
• Alternative Catalog Number: ABB-A8374-20UL,ABB-A8374-100UL,ABB-A8374-500UL,ABB-A8374-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RAM41, TAM41, C3orf31, COXPD56, TAMM41

Product Description

Predicted to enable phosphatidate cytidylyltransferase activity. Predicted to be involved in CDP-diacylglycerol biosynthetic process and cardiolipin biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be extrinsic component of mitochondrial inner membrane. Predicted to be active in mitochondrion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 132001
• UniProt: Q96BW9
• Purity: Affinity purification
• Sequence: SLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQV
• Target: TAMM41
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TAMM41 Rabbit pAb (A8374) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.