BTLA Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: BTLA Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A8377
• Hersteller Artikelnummer: A8377
• Alternativnummer: ABB-A8377-20UL,ABB-A8377-100UL,ABB-A8377-1000UL,ABB-A8377-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BTLA1, CD272, BTLA

Produktbeschreibung

This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 33kDa
• NCBI: 151888
• UniProt: Q7Z6A9
• Reinheit: Affinity purification
• Sequenz: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
• Target-Kategorie: BTLA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using BTLA Rabbit pAb (A8377) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.