BTLA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BTLA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8377
• Supplier Catalog Number: A8377
• Alternative Catalog Number: ABB-A8377-20UL,ABB-A8377-100UL,ABB-A8377-1000UL,ABB-A8377-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BTLA1, CD272, BTLA

Product Description

This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 151888
• UniProt: Q7Z6A9
• Purity: Affinity purification
• Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
• Target: BTLA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BTLA Rabbit pAb (A8377) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.